Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC11A2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004891-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC11A2 partial ORF ( NP_000608, 1 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.89
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004891-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4891
  • Gene Name:
  • SLC11A2
  • Gene Alias:
  • DCT1,DMT1,FLJ37416,NRAMP2
  • Gene Description:
  • solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
  • Gene Summary:
  • The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM
  • Other Designations:
  • natural resistance-associated macrophage protein 2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook