NPTX1 monoclonal antibody (M06), clone 7E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6.
Lane 1: NPTX1 transfected lysate (Predicted MW: 47.52 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NPTX1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NPTX1.
Immunogen
NPTX1 (NP_002513.2, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6.
Lane 1: NPTX1 transfected lysate (Predicted MW: 47.52 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NPTX1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — NPTX1
Entrez GeneID
4884GeneBank Accession#
NM_002522Protein Accession#
NP_002513.2Gene Name
NPTX1
Gene Alias
DKFZp686J2446, MGC105123, NP1
Gene Description
neuronal pentraxin I
Omim ID
602367Gene Ontology
HyperlinkGene Summary
NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com