Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NPPA (Human) Recombinant Protein (P01)

  • Catalog # : H00004878-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NPPA full-length ORF ( AAH05893, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.57
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004878-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4878
  • Gene Name:
  • NPPA
  • Gene Alias:
  • ANF,ANP,ATFB6,CDD-ANF,PND
  • Gene Description:
  • natriuretic peptide precursor A
  • Gene Summary:
  • The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002504,OTTHUMP00000044485,atrial natriuretic peptide,natriuretic peptide precursor A variant 2,pronatriodilatin
  • RSS
  • YouTube
  • Linkedin
  • Facebook