Product Browser

Last updated: 2017/5/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NPPA polyclonal antibody (A01)

  • Catalog # : H00004878-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant NPPA.
  • Immunogen:
  • NPPA (AAH05893, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004878-A01
    Western Blot detection against Immunogen (42.94 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4878
  • Gene Name:
  • NPPA
  • Gene Alias:
  • ANF,ANP,ATFB6,CDD-ANF,PND
  • Gene Description:
  • natriuretic peptide precursor A
  • Gene Summary:
  • The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000002504,OTTHUMP00000044485,atrial natriuretic peptide,natriuretic peptide precursor A variant 2,pronatriodilatin
  • RSS
  • YouTube
  • Linkedin
  • Facebook