Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NPM1 (Human) Recombinant Protein (P01)

  • Catalog # : H00004869-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NPM1 full-length ORF ( AAH02398.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 58.08
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004869-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4869
  • Gene Name:
  • NPM1
  • Gene Alias:
  • B23,MGC104254,NPM
  • Gene Description:
  • nucleophosmin (nucleolar phosphoprotein B23, numatrin)
  • Gene Summary:
  • NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM
  • Other Designations:
  • nucleolar phosphoprotein B23,nucleophosmin 1,nucleophosmin/nucleoplasmin family, member 1,numatrin
  • RSS
  • YouTube
  • Linkedin
  • Facebook