NP monoclonal antibody (M01), clone 6E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NP expression in transfected 293T cell line by NP monoclonal antibody (M01), clone 6E5.
Lane 1: NP transfected lysate (Predicted MW: 32.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NP is 10 ng/ml as a capture antibody.
Western Blot detection against Immunogen (58.5 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant NP.
Immunogen
NP (NP_000261.1, 1 a.a. ~ 289 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (58.5 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NP expression in transfected 293T cell line by NP monoclonal antibody (M01), clone 6E5.
Lane 1: NP transfected lysate (Predicted MW: 32.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NP is 10 ng/ml as a capture antibody.ELISA
-
Gene Info — NP
Entrez GeneID
4860GeneBank Accession#
NM_000270.1Protein Accession#
NP_000261.1Gene Name
NP
Gene Alias
FLJ94043, FLJ97288, FLJ97312, MGC117396, MGC125915, MGC125916, PNP, PRO1837, PUNP
Gene Description
nucleoside phosphorylase
Omim ID
164050Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq
Other Designations
inosine phosphorylase|purine nucleoside phosphorylase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com