Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NP polyclonal antibody (A01)

  • Catalog # : H00004860-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NP.
  • Immunogen:
  • NP (NP_000261, 174 a.a. ~ 283 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004860-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NP polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of NP expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4860
  • Gene Name:
  • NP
  • Gene Alias:
  • FLJ94043,FLJ97288,FLJ97312,MGC117396,MGC125915,MGC125916,PNP,PRO1837,PUNP
  • Gene Description:
  • nucleoside phosphorylase
  • Gene Summary:
  • This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq
  • Other Designations:
  • inosine phosphorylase,purine nucleoside phosphorylase
  • RSS
  • YouTube
  • Linkedin
  • Facebook