NOVA1 monoclonal antibody (M10), clone 5D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NOVA1 monoclonal antibody (M10), clone 5D9. Western Blot analysis of NOVA1 expression in PC-12 ( Cat # L012V1 ).
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NOVA1.
Immunogen
NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NOVA1 monoclonal antibody (M10), clone 5D9. Western Blot analysis of NOVA1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — NOVA1
Entrez GeneID
4857GeneBank Accession#
NM_002515Protein Accession#
NP_002506Gene Name
NOVA1
Gene Alias
Nova-1
Gene Description
neuro-oncological ventral antigen 1
Omim ID
602157Gene Ontology
HyperlinkGene Summary
This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
paraneoplastic Ri antigen|ventral neuron-specific protein 1
-
Interactome
-
Disease
-
Publication Reference
-
Electroacupuncture at PC6 (Neiguan) Attenuates Angina Pectoris in Rats with Myocardial Ischemia-Reperfusion Injury Through Regulating the Alternative Splicing of the Major Inhibitory Neurotransmitter Receptor GABRG2.
Wenchuan Qi, Hongjuan Fu, Xinye Luo, Yanrong Ren, Xueying Liu, Hongyuan Dai, Qianhua Zheng, Fanrong Liang.
Journal of Cardiovascular Translational Research 2022 Oct; 15(5):1176.
Application：WB-Ce, WB-Tr, Rats, DRG cells, Rat myocardial.
-
The impact of the RBM4-initiated splicing cascade on modulating the carcinogenic signature of colorectal cancer cells.
Lin JC, Lee YC, Liang YC, Fann YC, Johnson KR, Lin YJ.
Scientific Reports 2017 Mar; 7:44204.
Application：WB-Ti, WB-Tr, Human, Human colon cancer, HCT-8, HCT-116, Colo205 cells.
-
RBM4–Nova1–SRSF6 splicing cascade modulates the development of brown adipocytes.
Lin JC, Chi YL, Peng HY, Lu LH.
Biochimica et Biophysica acta 2016 Nov; 1859(11):1368.
Application：WB-Tr, Mouse, C3H10T1/2 cells.
-
Electroacupuncture at PC6 (Neiguan) Attenuates Angina Pectoris in Rats with Myocardial Ischemia-Reperfusion Injury Through Regulating the Alternative Splicing of the Major Inhibitory Neurotransmitter Receptor GABRG2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com