NOTCH3 monoclonal antibody (M01), clone 1G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NOTCH3.
Immunogen
NOTCH3 (NP_000426, 47 a.a. ~ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NOTCH3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — NOTCH3
Entrez GeneID
4854GeneBank Accession#
NM_000435Protein Accession#
NP_000426Gene Name
NOTCH3
Gene Alias
CADASIL, CASIL
Gene Description
Notch homolog 3 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq
Other Designations
Notch homolog 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A mid-position NOTCH3 truncation in inherited cerebral small vessel disease may affect the protein interactome.
Soo Jung Lee, Xiaojie Zhang, Gang Xu, Jimo Borjigin, Michael M Wang.
The Journal of Biological Chemistry 2023 Jan; 299(1):102772.
Application:WB-Ce, Human, HEK 293T cells.
-
NOTCH3-targeted antibody drug conjugates regress tumors by inducing apoptosis in receptor cells and through transendocytosis into ligand cells.
Kenneth G Geles, Yijie Gao, Andreas Giannakou, Latha Sridharan, Ting-Ting Yamin, Jing Zhang, Riyez Karim, Joel Bard, Nicole Piche-Nicholas, Manoj Charati, Andreas Maderna, Judy Lucas, Jonathon Golas, Magali Guffroy, Steven Pirie-Shepherd, Marc Roy, Jessie Qian, Tania Franks, Wenyan Zhong, Christopher J O'Donnell, Lioudmila Tchistiakova, Hans-Peter Gerber, Puja Sapra.
Cell Reports. Medicine 2021 May; 2(5):100279.
Application:WB-Ce, WB-Tr, Human, MDA-MB-468 cells.
-
Lunatic fringe promotes the aggregation of CADASIL NOTCH3 mutant proteins.
Shodai Suzuki, Satoshi Hiura, Taiki Mashiko, Takemi Matsumoto, Motoyuki Itoh.
Biochemical and Biophysical Research Communications 2021 Jun; 557:302.
Application:WB-Tr, Human, HEK 293T, JAG1-3T3, MIG-3T3 cells.
-
Anti-osteoarthritis effect of a combination treatment with human adipose tissue-derived mesenchymal stem cells and thrombospondin 2 in rabbits.
Shin K, Cha Y, Ban YH, Seo DW, Choi EK, Park D, Kang SK, Ra JC, Kim YB.
World Journal of Stem Cells 2019 Dec; 11(12):1115.
Application:IF, IHC-Fr, Human, Human adipose tissue-derived mesenchymal stem cells.
-
Serum amyloid P component: A novel potential player in vessel degeneration in CADASIL.
Nagatoshi A, Ueda M, Ueda A, Tasaki M, Inoue Y, Ma Y, Masuda T, Mizukami M, Matsumoto S, Kosaka T, Kawano T, Ito T, Ando Y.
Journal of the Neurological Sciences 2017 May; 379:69.
Application:IF, IHC-P, Human, Artery from patients with leukoencephalopathy.
-
Von Willebrand Factor Inhibits Mature Smooth Muscle Gene Expression through Impairment of Notch Signaling.
Meng H, Zhang X, Lee SJ, Wang MM.
PLoS One. 2013 Sep; 8(9):e75808.
Application:WB, Human, 293A cells.
-
Functional analysis of the Notch ligand Jagged1 missense mutant proteins underlying Alagille syndrome.
Tada M, Itoh S, Ishii-Watabe A, Suzuki T, Kawasaki N.
The FEBS Journal 2012 Jun; 279(12):2096.
Application:WB-Tr, Human, HeLa cells.
-
Bidirectional encroachment of collagen into the tunica media in cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy.
Dong H, Blaivas M, Wang MM.
Brain Research 2012 May; 1456:64.
Application:IHC-P, Human, Brain.
-
Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy affecting an African American man: identification of a novel 15-base pair NOTCH3 duplication.
Lee SJ, Meng H, Elmadhoun O, Blaivas M, Wang MM.
Archives of Neurology 2011 Dec; 68(12):1584.
Application:WB-Ti, Human, Frontal cortex.
-
Transendocytosis is impaired in CADASIL-mutant NOTCH3.
Watanabe-Hosomi A, Watanabe Y, Tanaka M, Nakagawa M, Mizuno T.
Experimental Neurology 2012 Jan; 233(1):303.
Application:IF, WB-Ce, Human, HEK 293 cells.
-
Thrombospondin2 potentiates notch3/Jagged1 signaling.
Meng H, Zhang X, Hankenson KD, Wang MM.
The Journal of Biological Chemistry 2009 Mar; 284(12):7866.
Application:WB-Ce, Human, H460 cells.
-
Identification of Pbx1, a Potential Oncogene, as a Notch3 Target Gene in Ovarian Cancer.
Park JT, Shih IeM, Wang TL.
Cancer Research 2008 Nov; 68(21):8852.
Application:WB-Ce, Human, A2780, ES-2, MCF7, MPSC1, OVCAR3, SK-OV-3, TOV21G cells.
-
A mid-position NOTCH3 truncation in inherited cerebral small vessel disease may affect the protein interactome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com