NOTCH1 monoclonal antibody (M10), clone 4G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NOTCH1.
Immunogen
NOTCH1 (NP_060087, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (88); Rat (86)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NOTCH1 monoclonal antibody (M10), clone 4G1. Western Blot analysis of NOTCH1 expression in Raw 264.7(Cat # L024V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NOTCH1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — NOTCH1
Entrez GeneID
4851GeneBank Accession#
NM_017617Protein Accession#
NP_060087Gene Name
NOTCH1
Gene Alias
TAN1, hN1
Gene Description
Notch homolog 1, translocation-associated (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development. [provided by RefSeq
Other Designations
OTTHUMP00000022594|neurogenic locus notch homolog protein 1|notch1|translocation-associated notch protein TAN-1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
FBXW7 suppresses epithelial-mesenchymal transition and chemo-resistance of non-small-cell lung cancer cells by targeting snai1 for ubiquitin-dependent degradation.
Xiao G, Li Y, Wang M, Li X, Qin S, Sun X, Liang R, Zhang B, Du N, Xu C, Ren H, Liu D.
Cell proliferation 2018 Oct; 51(5):e12473.
Application:WB-Tr, Human, A549, H1299 cells.
-
FBXW7 suppresses epithelial-mesenchymal transition and chemo-resistance of non-small-cell lung cancer cells by targeting snai1 for ubiquitin-dependent degradation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com