Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NODAL monoclonal antibody (M05), clone 5A3

  • Catalog # : H00004838-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NODAL.
  • Immunogen:
  • NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004838-M05
    Western Blot detection against Immunogen (33.66 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NODAL monoclonal antibody (M05), clone 5A3 Western Blot analysis of NODAL expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NODAL monoclonal antibody (M05), clone 5A3. Western Blot analysis of NODAL expression in PC-12 ( Cat # L012V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NODAL monoclonal antibody (M05), clone 5A3. Western Blot analysis of NODAL expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged NODAL is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4838
  • Gene Name:
  • NODAL
  • Gene Alias:
  • MGC138230
  • Gene Description:
  • nodal homolog (mouse)
  • Gene Summary:
  • The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019754,nodal,nodal, mouse, homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook