NODAL monoclonal antibody (M05), clone 5A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NODAL monoclonal antibody (M05), clone 5A3 Western Blot analysis of NODAL expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
NODAL monoclonal antibody (M05), clone 5A3. Western Blot analysis of NODAL expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
NODAL monoclonal antibody (M05), clone 5A3. Western Blot analysis of NODAL expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NODAL is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.66 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NODAL.
Immunogen
NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NODAL monoclonal antibody (M05), clone 5A3 Western Blot analysis of NODAL expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NODAL monoclonal antibody (M05), clone 5A3. Western Blot analysis of NODAL expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
NODAL monoclonal antibody (M05), clone 5A3. Western Blot analysis of NODAL expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NODAL is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — NODAL
Entrez GeneID
4838GeneBank Accession#
NM_018055Protein Accession#
NP_060525Gene Name
NODAL
Gene Alias
MGC138230
Gene Description
nodal homolog (mouse)
Omim ID
601265Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development. [provided by RefSeq
Other Designations
OTTHUMP00000019754|nodal|nodal, mouse, homolog
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com