NME2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NME2 partial ORF ( NP_002503, 51 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NME2
Entrez GeneID
4831GeneBank Accession#
NM_002512Protein Accession#
NP_002503Gene Name
NME2
Gene Alias
MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf
Gene Description
non-metastatic cells 2, protein (NM23B) expressed in
Omim ID
156491Gene Ontology
HyperlinkGene Summary
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations
NDP kinase B|OTTHUMP00000174727|OTTHUMP00000174728|OTTHUMP00000174774|OTTHUMP00000174775|OTTHUMP00000174776|c-myc transcription factor|non-metastatic cells 2, protein (NM23) expressed in
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com