NME2 monoclonal antibody (M11), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NME2.
Immunogen
NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NME2 monoclonal antibody (M11), clone 1E4 Western Blot analysis of NME2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
NME2 monoclonal antibody (M11), clone 1E4. Western Blot analysis of NME2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME2 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NME2
Entrez GeneID
4831GeneBank Accession#
NM_002512Protein Accession#
NP_002503Gene Name
NME2
Gene Alias
MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf
Gene Description
non-metastatic cells 2, protein (NM23B) expressed in
Omim ID
156491Gene Ontology
HyperlinkGene Summary
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations
NDP kinase B|OTTHUMP00000174727|OTTHUMP00000174728|OTTHUMP00000174774|OTTHUMP00000174775|OTTHUMP00000174776|c-myc transcription factor|non-metastatic cells 2, protein (NM23) expressed in
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com