NME2 monoclonal antibody (M06), clone 1D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NME2.
Immunogen
NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NME2 monoclonal antibody (M06), clone 1D3. Western Blot analysis of NME2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
NME2 monoclonal antibody (M06), clone 1D3 Western Blot analysis of NME2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NME2 monoclonal antibody (M06), clone 1D3. Western Blot analysis of NME2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
NME2 monoclonal antibody (M06), clone 1D3. Western Blot analysis of NME2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NME2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME2 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NME2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NME2
Entrez GeneID
4831GeneBank Accession#
NM_002512Protein Accession#
NP_002503Gene Name
NME2
Gene Alias
MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf
Gene Description
non-metastatic cells 2, protein (NM23B) expressed in
Omim ID
156491Gene Ontology
HyperlinkGene Summary
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations
NDP kinase B|OTTHUMP00000174727|OTTHUMP00000174728|OTTHUMP00000174774|OTTHUMP00000174775|OTTHUMP00000174776|c-myc transcription factor|non-metastatic cells 2, protein (NM23) expressed in
-
Interactome
-
Pathway
-
Publication Reference
-
Early Insights into the Function of KIAA1199, a Markedly Overexpressed Protein in Human Colorectal Tumors.
Tiwari A, Schneider M, Fiorino A, Haider R, Okoniewski MJ, Roschitzki B, Uzozie A, Menigatti M, Jiricny J, Marra G.
PLoS One 2013 Jul; 8(7):e69473.
Application:IP, WB, Human, SW480 cells.
-
Early Insights into the Function of KIAA1199, a Markedly Overexpressed Protein in Human Colorectal Tumors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com