Product Browser

Last updated: 2017/3/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NME2 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00004831-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NME2 protein.
  • Immunogen:
  • NME2 (NP_002503.1, 1 a.a. ~ 152 a.a) full-length human protein.
  • Sequence:
  • MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of NME2 transfected lysate using anti-NME2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NME2 monoclonal antibody (M12), clone 4A7 (H00004831-M12).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 4831
  • Gene Name:
  • NME2
  • Gene Alias:
  • MGC111212,NDPK-B,NDPKB,NM23-H2,NM23B,puf
  • Gene Description:
  • non-metastatic cells 2, protein (NM23B) expressed in
  • Gene Summary:
  • Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
  • Other Designations:
  • NDP kinase B,OTTHUMP00000174727,OTTHUMP00000174728,OTTHUMP00000174774,OTTHUMP00000174775,OTTHUMP00000174776,c-myc transcription factor,non-metastatic cells 2, protein (NM23) expressed in
  • RSS
  • YouTube
  • Linkedin
  • Facebook