NME1 monoclonal antibody (M01), clone 2H1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NME1 monoclonal antibody (M01), clone 2H1 Western Blot analysis of NME1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M01), clone 2H1.
Lane 1: NME1 transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME1 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of NME1 over-expressed 293 cell line, cotransfected with NME1 Validated Chimera RNAi ( Cat # H00004830-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NME1 monoclonal antibody (M01), clone 2H1 (Cat # H00004830-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 20 ug/ml]
Western Blot detection against Immunogen (42.46 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NME1.
Immunogen
NME1 (AAH00293, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.46 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NME1 monoclonal antibody (M01), clone 2H1 Western Blot analysis of NME1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M01), clone 2H1.
Lane 1: NME1 transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NME1 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NME1 over-expressed 293 cell line, cotransfected with NME1 Validated Chimera RNAi ( Cat # H00004830-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NME1 monoclonal antibody (M01), clone 2H1 (Cat # H00004830-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — NME1
Entrez GeneID
4830GeneBank Accession#
BC000293Protein Accession#
AAH00293Gene Name
NME1
Gene Alias
AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1
Gene Description
non-metastatic cells 1, protein (NM23A) expressed in
Gene Ontology
HyperlinkGene Summary
This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
Other Designations
NDP kinase A|OTTHUMP00000174772
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com