Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NNAT (Human) Recombinant Protein (P01)

  • Catalog # : H00004826-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NNAT full-length ORF ( AAH01768, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.65
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004826-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4826
  • Gene Name:
  • NNAT
  • Gene Alias:
  • MGC1439,Peg5
  • Gene Description:
  • neuronatin
  • Gene Summary:
  • The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele, while BLCAP is not imprinted. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030933,OTTHUMP00000030934
  • RSS
  • YouTube
  • Linkedin
  • Facebook