Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NKX3-1 polyclonal antibody (A01)

  • Catalog # : H00004824-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NKX3-1.
  • Immunogen:
  • NKX3-1 (NP_006158, 100 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004824-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4824
  • Gene Name:
  • NKX3-1
  • Gene Alias:
  • BAPX2,NKX3,NKX3.1,NKX3A
  • Gene Description:
  • NK3 homeobox 1
  • Gene Summary:
  • The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM
  • Other Designations:
  • NK homeobox, family 3, A,NK3 transcription factor homolog A,NK3 transcription factor related, locus 1,OTTHUMP00000123534
  • RSS
  • YouTube
  • Linkedin
  • Facebook