Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NKX2-2 (Human) Recombinant Protein (P01)

  • Catalog # : H00004821-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NKX2-2 full-length ORF ( ABZ92170.1, 1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4821
  • Gene Name:
  • NKX2-2
  • Gene Alias:
  • NKX2.2,NKX2B
  • Gene Description:
  • NK2 homeobox 2
  • Gene Summary:
  • The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. [provided by RefSeq
  • Other Designations:
  • NK-2 homolog B,NK2 transcription factor related, locus 2,NK2 transcription factor-like protein B,OTTHUMP00000030405,homeobox protein NK-2 homolog B
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook