NKTR (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NKTR partial ORF ( NP_005376.2, 888 a.a. - 984 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ESNSERDVTKNSKNDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHGSKEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Interspecies Antigen Sequence
Mouse (61)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NKTR
Entrez GeneID
4820GeneBank Accession#
NM_005385Protein Accession#
NP_005376.2Gene Name
NKTR
Gene Alias
DKFZp686F1754, DKFZp686G0426, DKFZp686J06106, DKFZp686N24126, MGC90527, p104
Gene Description
natural killer-tumor recognition sequence
Omim ID
161565Gene Ontology
HyperlinkGene Summary
This gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2 activation of the cells. [provided by RefSeq
Other Designations
NK-TR protein|NK-tumor recognition protein|natural killer triggering receptor|natural-killer cells cyclophilin-related protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com