NHP2L1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NHP2L1 partial ORF ( AAH05358, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NHP2L1
Entrez GeneID
4809GeneBank Accession#
BC005358Protein Accession#
AAH05358Gene Name
NHP2L1
Gene Alias
15.5K, FA-1, FA1, NHPX, OTK27, SNRNP15-5, SNU13, SPAG12, SSFA1
Gene Description
NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
Omim ID
601304Gene Ontology
HyperlinkGene Summary
Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
NHP2 non-histone chromosome protein 2-like 1|[U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein|high mobility group-like nuclear protein 2 homolog 1|non-histone chromosome protein 2-like 1|small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5)|sperm specific an
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com