Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NHP2L1 (Human) Recombinant Protein (P01)

  • Catalog # : H00004809-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NHP2L1 full-length ORF ( NP_001003796.1, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004809-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4809
  • Gene Name:
  • NHP2L1
  • Gene Alias:
  • 15.5K,FA-1,FA1,NHPX,OTK27,SNRNP15-5,SNU13,SPAG12,SSFA1
  • Gene Description:
  • NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
  • Gene Summary:
  • Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NHP2 non-histone chromosome protein 2-like 1,[U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein,high mobility group-like nuclear protein 2 homolog 1,non-histone chromosome protein 2-like 1,small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5),sperm specific an
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook