Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NHP2L1 monoclonal antibody (M02), clone 5C5

  • Catalog # : H00004809-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NHP2L1.
  • Immunogen:
  • NHP2L1 (AAH05358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged NHP2L1 is approximately 0.1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4809
  • Gene Name:
  • NHP2L1
  • Gene Alias:
  • 15.5K,FA-1,FA1,NHPX,OTK27,SNRNP15-5,SNU13,SPAG12,SSFA1
  • Gene Description:
  • NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
  • Gene Summary:
  • Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NHP2 non-histone chromosome protein 2-like 1,[U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein,high mobility group-like nuclear protein 2 homolog 1,non-histone chromosome protein 2-like 1,small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5),sperm specific an
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook