Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NGFR monoclonal antibody (M06), clone 5C5

  • Catalog # : H00004804-M06
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NGFR.
  • Immunogen:
  • NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4804
  • Gene Name:
  • NGFR
  • Gene Alias:
  • CD271,Gp80-LNGFR,TNFRSF16,p75(NTR),p75NTR
  • Gene Description:
  • nerve growth factor receptor (TNFR superfamily, member 16)
  • Gene Summary:
  • Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain. [provided by RefSeq
  • Other Designations:
  • low affinity nerve growth factor receptor,low-affinity nerve growth factor receptor,nerve growth factor receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook