NFYC monoclonal antibody (M01), clone 1D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NFYC.
Immunogen
NFYC (AAH05003, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NFYC expression in transfected 293T cell line by NFYC monoclonal antibody (M01), clone 1D3.
Lane 1: NFYC transfected lysate(37.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NFYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NFYC is 3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NFYC over-expressed 293 cell line, cotransfected with NFYC Validated Chimera RNAi ( Cat # H00004802-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NFYC monoclonal antibody (M01), clone 1D3 (Cat # H00004802-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to NFYC on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — NFYC
Entrez GeneID
4802GeneBank Accession#
BC005003Protein Accession#
AAH05003Gene Name
NFYC
Gene Alias
CBF-C, CBFC, DKFZp667G242, FLJ45775, H1TF2A, HAP5, HSM, NF-YC
Gene Description
nuclear transcription factor Y, gamma
Omim ID
605344Gene Ontology
HyperlinkGene Summary
This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CCAAT binding factor subunit C|CCAAT transcription binding factor subunit gamma|OTTHUMP00000009207|OTTHUMP00000009208|OTTHUMP00000009211|OTTHUMP00000009212|histone H1 transcription factor large subunit 2A|transactivator HSM-1|transcription factor NF-Y, C
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com