NFYC purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NFYC expression in transfected 293T cell line (H00004802-T01) by NFYC MaxPab polyclonal antibody.
Lane 1: NFYC transfected lysate(37.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NFYC protein.
Immunogen
NFYC (NP_055038.2, 1 a.a. ~ 335 a.a) full-length human protein.
Sequence
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NFYC expression in transfected 293T cell line (H00004802-T01) by NFYC MaxPab polyclonal antibody.
Lane 1: NFYC transfected lysate(37.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NFYC
Entrez GeneID
4802GeneBank Accession#
NM_014223.2Protein Accession#
NP_055038.2Gene Name
NFYC
Gene Alias
CBF-C, CBFC, DKFZp667G242, FLJ45775, H1TF2A, HAP5, HSM, NF-YC
Gene Description
nuclear transcription factor Y, gamma
Omim ID
605344Gene Ontology
HyperlinkGene Summary
This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CCAAT binding factor subunit C|CCAAT transcription binding factor subunit gamma|OTTHUMP00000009207|OTTHUMP00000009208|OTTHUMP00000009211|OTTHUMP00000009212|histone H1 transcription factor large subunit 2A|transactivator HSM-1|transcription factor NF-Y, C
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com