Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFYC purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004802-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NFYC protein.
  • Immunogen:
  • NFYC (NP_055038.2, 1 a.a. ~ 335 a.a) full-length human protein.
  • Sequence:
  • MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NFYC expression in transfected 293T cell line (H00004802-T01) by NFYC MaxPab polyclonal antibody.

    Lane 1: NFYC transfected lysate(37.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4802
  • Gene Name:
  • NFYC
  • Gene Alias:
  • CBF-C,CBFC,DKFZp667G242,FLJ45775,H1TF2A,HAP5,HSM,NF-YC
  • Gene Description:
  • nuclear transcription factor Y, gamma
  • Gene Summary:
  • This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CCAAT binding factor subunit C,CCAAT transcription binding factor subunit gamma,OTTHUMP00000009207,OTTHUMP00000009208,OTTHUMP00000009211,OTTHUMP00000009212,histone H1 transcription factor large subunit 2A,transactivator HSM-1,transcription factor NF-Y, C
  • RSS
  • YouTube
  • Linkedin
  • Facebook