Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFKBIL2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004796-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NFKBIL2 partial ORF ( NP_038460, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRTRLYLNLGLTFESLQQTALCNDYFRKSIFLAEQNHLYEDLFRARYNLGTIHWRAGQHSQAMRCLEGARECAHTMRKRFMESECCVVIAQVLQDLG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004796-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4796
  • Gene Name:
  • NFKBIL2
  • Gene Alias:
  • FLJ40087,IKBR
  • Gene Description:
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2
  • Gene Summary:
  • The protein encoded by this gene is thought to be a negative regulator of NF-kappa-B mediated transcription. The encoded protein may bind NF-kappa-B complexes and trap them in the cytoplasm, preventing them from entering the nucleus and interacting with the DNA. Phosphorylation of this protein targets it for degradation by the ubiquitination pathway, which frees the NF-kappa-B complexes to enter the nucleus. [provided by RefSeq
  • Other Designations:
  • I-kappa-B-related protein,NF-kappa-B inhibitor-like protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook