Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFE2L1 polyclonal antibody (A01)

  • Catalog # : H00004779-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NFE2L1.
  • Immunogen:
  • NFE2L1 (NP_003195, 677 a.a. ~ 771 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004779-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4779
  • Gene Name:
  • NFE2L1
  • Gene Alias:
  • FLJ00380,LCR-F1,NRF1,TCF11
  • Gene Description:
  • nuclear factor (erythroid-derived 2)-like 1
  • Gene Summary:
  • This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for "nuclear respiratory factor 1" which has an official symbol of NRF1. [provided by RefSeq
  • Other Designations:
  • transcription factor 11 (basic leucine zipper type)
  • RSS
  • YouTube
  • Linkedin
  • Facebook