Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NFATC2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004773-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NFATC2 partial ORF ( NP_036472, 812 a.a. - 921 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSWIQNIL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004773-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4773
  • Gene Name:
  • NFATC2
  • Gene Alias:
  • KIAA0611,NFAT1,NFATP
  • Gene Description:
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
  • Gene Summary:
  • This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • NFAT pre-existing subunit,NFAT transcription complex, preexisting component,OTTHUMP00000031291,T cell transcription factor NFAT1,nuclear factor of activated T-cells, cytoplasmic 2,nuclear factor of activated T-cells, preexisting component,preexisting nucl
  • RSS
  • YouTube
  • Linkedin
  • Facebook