NEU2 monoclonal antibody (M03), clone 3B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human liver.
Western Blot (Tissue lysate)
NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human fetal liver.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEU2.
Immunogen
NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (69)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human liver.Western Blot (Tissue lysate)
NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human fetal liver.Western Blot (Recombinant protein)
ELISA
-
Gene Info — NEU2
Entrez GeneID
4759GeneBank Accession#
NM_005383Protein Accession#
NP_005374Gene Name
NEU2
Gene Alias
MGC129579, SIAL2
Gene Description
sialidase 2 (cytosolic sialidase)
Omim ID
605528Gene Ontology
HyperlinkGene Summary
This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq
Other Designations
N-acetyl-alpha-neuraminidase 2|OTTHUMP00000164374|cytosolic sialidase|neuraminidase 2|sialidase 2
-
Interactome
-
Pathway
-
Publication Reference
-
Increased concentration of sialidases by HeLa cells might influence the cytotoxic ability of NK cells.
Lee WC, Lee WL, Shyong WY, Yang LW, Ko MC, Sheu BC, Hsieh SL, Wang PH.
Taiwanese Journal of Obstetrics & Gynecology 2012 Jun; 51(2):192.
Application：WB-Ce, Human, HeLa cells.
-
Macrophages discriminate glycosylation patterns of apoptotic cell-derived microparticles.
Bilyy RO, Shkandina T, Tomin A, Munoz LE, Franz S, Antonyuk V, Kit YY, Zirngibl M, Fuernrohr BG, Janko C, Lauber K, Schiller M, Schett G, Stoika RS, Herrmann M.
The Journal of Biological Chemistry 2012 Jan; 287(1):496.
Application：Func, Human, Jurkat cells.
-
Increased concentration of sialidases by HeLa cells might influence the cytotoxic ability of NK cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com