Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NEU2 polyclonal antibody (A01)

  • Catalog # : H00004759-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NEU2.
  • Immunogen:
  • NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004759-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NEU2 polyclonal antibody (A01). Western Blot analysis of NEU2 expression in rat brain.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4759
  • Gene Name:
  • NEU2
  • Gene Alias:
  • MGC129579,SIAL2
  • Gene Description:
  • sialidase 2 (cytosolic sialidase)
  • Gene Summary:
  • This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq
  • Other Designations:
  • N-acetyl-alpha-neuraminidase 2,OTTHUMP00000164374,cytosolic sialidase,neuraminidase 2,sialidase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook