Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NEU1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004758-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NEU1 partial ORF ( NP_000425, 334 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.76
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004758-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4758
  • Gene Name:
  • NEU1
  • Gene Alias:
  • FLJ93471,NANH,NEU,SIAL1
  • Gene Description:
  • sialidase 1 (lysosomal sialidase)
  • Gene Summary:
  • The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq
  • Other Designations:
  • G9 sialidase,N-acetyl-alpha-neuraminidase 1,OTTHUMP00000029419,acetylneuraminyl hydrolase,exo-alpha-sialidase,lysosomal sialidase,neuraminidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook