Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NEK3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004752-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NEK3 partial ORF ( AAH19916, 406 a.a. - 506 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDWVSELKKRAGWQGLCDR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004752-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4752
  • Gene Name:
  • NEK3
  • Gene Alias:
  • HSPK36,MGC29949
  • Gene Description:
  • NIMA (never in mitosis gene a)-related kinase 3
  • Gene Summary:
  • This gene encodes a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. The encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase. Multiple transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • NIMA-related kinase 3,glycogen synthase A kinase,hydroxyalkyl-protein kinase,phosphorylase B kinase kinase,serine/threonine-protein kinase NEK3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook