NEK3 monoclonal antibody (M01), clone 2F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NEK3 expression in transfected 293T cell line by NEK3 monoclonal antibody (M01), clone 2F8.
Lane 1: NEK3 transfected lysate(57.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK3 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEK3.
Immunogen
NEK3 (AAH19916, 406 a.a. ~ 506 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDWVSELKKRAGWQGLCDR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (77)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NEK3 expression in transfected 293T cell line by NEK3 monoclonal antibody (M01), clone 2F8.
Lane 1: NEK3 transfected lysate(57.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK3 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NEK3
Entrez GeneID
4752GeneBank Accession#
BC019916Protein Accession#
AAH19916Gene Name
NEK3
Gene Alias
HSPK36, MGC29949
Gene Description
NIMA (never in mitosis gene a)-related kinase 3
Omim ID
604044Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. The encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase. Multiple transcript variants encoding different isoforms have been found for this gene
Other Designations
NIMA-related kinase 3|glycogen synthase A kinase|hydroxyalkyl-protein kinase|phosphorylase B kinase kinase|serine/threonine-protein kinase NEK3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com