NEK2 monoclonal antibody (M11), clone 3B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7. Western Blot analysis of NEK2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7. Western Blot analysis of NEK2 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7 Western Blot analysis of NEK2 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7. Western Blot analysis of NEK2 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 25 ug/ml]
Western Blot detection against Immunogen (38.28 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEK2.
Immunogen
NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7. Western Blot analysis of NEK2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7. Western Blot analysis of NEK2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7 Western Blot analysis of NEK2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
NEK2 monoclonal antibody (M11), clone 3B7. Western Blot analysis of NEK2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK2 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NEK2 on HeLa cell. [antibody concentration 25 ug/ml] -
Gene Info — NEK2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com