NEK2 monoclonal antibody (M01), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NEK2 expression in transfected 293T cell line by NEK2 monoclonal antibody (M01), clone 2F6.
Lane 1: NEK2 transfected lysate(51.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NEK2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
Immunoprecipitation
Immunoprecipitation of NEK2 transfected lysate using anti-NEK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEK2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.28 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NEK2.
Immunogen
NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NEK2 expression in transfected 293T cell line by NEK2 monoclonal antibody (M01), clone 2F6.
Lane 1: NEK2 transfected lysate(51.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NEK2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]Immunoprecipitation
Immunoprecipitation of NEK2 transfected lysate using anti-NEK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEK2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NEK2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — NEK2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com