NELL1 monoclonal antibody (M01), clone 6A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody (M01), clone 6A8.
Lane 1: NELL1 transfected lysate(89.607 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of NELL1 transfected lysate using anti-NELL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NELL1 MaxPab rabbit polyclonal antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to NELL1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NELL1.
Immunogen
NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody (M01), clone 6A8.
Lane 1: NELL1 transfected lysate(89.607 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of NELL1 transfected lysate using anti-NELL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NELL1 MaxPab rabbit polyclonal antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NELL1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — NELL1
Entrez GeneID
4745GeneBank Accession#
NM_006157Protein Accession#
NP_006148Gene Name
NELL1
Gene Alias
FLJ45906, IDH3GL, NRP1
Gene Description
NEL-like 1 (chicken)
Omim ID
602319Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
isocitrate dehydrogenase 3 (NAD+) gamma-like|nel-like 1|neural epidermal growth factor-like 1
-
Interactome
-
Disease
-
Publication Reference
-
Interaction of Nel-like molecule 1 with apoptosis related protein 3 with its influence on human dental pulp cells proliferation and differentiation into odontoblasts.
Tian X, Wang Q, Wu J, Han Q, Shen L, Wei C, Song H, Li M, Fang Y, Wang X, Sun Q.
Biochemical and Biophysical Research Communications 2019 Oct; 518(2):246.
Application：IF, IP, WB-Tr, Human, Human dental pulp cells.
-
Systematic association mapping identifies NELL1 as a novel IBD disease gene.
Franke A, Hampe J, Rosenstiel P, Becker C, Wagner F, Hasler R, Little RD, Huse K, Ruether A, Balschun T, Wittig M, Elsharawy A, Mayr G, Albrecht M, Prescott NJ, Onnie CM, Fournier H, Keith T, Radelof U, Platzer M, Mathew CG, Stoll M, Krawczak M, Nurnberg.
PLoS ONE 2007 Aug; 2(8):e691.
Application：IHC-P, WB, Human, Human colon tissues.
-
Interaction of Nel-like molecule 1 with apoptosis related protein 3 with its influence on human dental pulp cells proliferation and differentiation into odontoblasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com