Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFV3 (Human) Recombinant Protein (P01)

  • Catalog # : H00004731-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDUFV3 full-length ORF ( NP_001001503.1, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.3
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004731-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4731
  • Gene Name:
  • NDUFV3
  • Gene Alias:
  • CI-9KD
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
  • Gene Summary:
  • The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD),NADH-ubiquinone oxidoreductase 9 kD subunit,NADH-ubiquinone oxidoreductase flavoprotein 3,NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD,complex I, mitochondrial respiratory chain, 10-kD subunit,m
  • RSS
  • YouTube
  • Linkedin
  • Facebook