NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NDUFV3 expression in transfected 293T cell line (H00004731-T02) by NDUFV3 MaxPab polyclonal antibody.
Lane 1: NDUFV3 transfected lysate(11.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NDUFV3 protein.
Immunogen
NDUFV3 (NP_001001503.1, 1 a.a. ~ 108 a.a) full-length human protein.
Sequence
MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (74)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NDUFV3 expression in transfected 293T cell line (H00004731-T02) by NDUFV3 MaxPab polyclonal antibody.
Lane 1: NDUFV3 transfected lysate(11.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NDUFV3
Entrez GeneID
4731GeneBank Accession#
NM_001001503.1Protein Accession#
NP_001001503.1Gene Name
NDUFV3
Gene Alias
CI-9KD
Gene Description
NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Omim ID
602184Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD)|NADH-ubiquinone oxidoreductase 9 kD subunit|NADH-ubiquinone oxidoreductase flavoprotein 3|NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD|complex I, mitochondrial respiratory chain, 10-kD subunit|m
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com