Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFV3 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004731-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NDUFV3 protein.
  • Immunogen:
  • NDUFV3 (NP_001001503.1, 1 a.a. ~ 108 a.a) full-length human protein.
  • Sequence:
  • MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFV3 expression in transfected 293T cell line (H00004731-T02) by NDUFV3 MaxPab polyclonal antibody.

    Lane 1: NDUFV3 transfected lysate(11.90 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4731
  • Gene Name:
  • NDUFV3
  • Gene Alias:
  • CI-9KD
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
  • Gene Summary:
  • The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD),NADH-ubiquinone oxidoreductase 9 kD subunit,NADH-ubiquinone oxidoreductase flavoprotein 3,NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD,complex I, mitochondrial respiratory chain, 10-kD subunit,m
  • RSS
  • YouTube
  • Linkedin
  • Facebook