Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFS4 (Human) Recombinant Protein (P01)

  • Catalog # : H00004724-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDUFS4 full-length ORF ( AAH05270, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.99
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004724-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4724
  • Gene Name:
  • NDUFS4
  • Gene Alias:
  • AQDQ
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
  • Gene Summary:
  • This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) Fe-S protein 4,NADH dehydrogenase (ubiquinone) iron-sulfur protein 4,NADH-coenzyme Q reductase, 18-KD,NADH-ubiquinone oxidoreductase 18 kDa subunit,mitochondrial respiratory chain complex I (18-KD subunit)
  • RSS
  • YouTube
  • Linkedin
  • Facebook