NDUFS4 monoclonal antibody (M01), clone 1A1

Catalog # H00004724-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

NDUFS4 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NDUFS4 expression in A-431 ( Cat # L015V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of NDUFS4 expression in transfected 293T cell line by NDUFS4 monoclonal antibody (M01), clone 1A1.

Lane 1: NDUFS4 transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to NDUFS4 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged NDUFS4 is approximately 0.3ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of NDUFS4 over-expressed 293 cell line, cotransfected with NDUFS4 Validated Chimera RNAi ( Cat # H00004724-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS4 monoclonal antibody (M01), clone 1A1 (Cat # H00004724-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant NDUFS4.

    Immunogen

    NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    NDUFS4 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NDUFS4 expression in A-431 ( Cat # L015V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of NDUFS4 expression in transfected 293T cell line by NDUFS4 monoclonal antibody (M01), clone 1A1.

    Lane 1: NDUFS4 transfected lysate(20.1 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to NDUFS4 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged NDUFS4 is approximately 0.3ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of NDUFS4 over-expressed 293 cell line, cotransfected with NDUFS4 Validated Chimera RNAi ( Cat # H00004724-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS4 monoclonal antibody (M01), clone 1A1 (Cat # H00004724-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — NDUFS4

    Entrez GeneID

    4724

    GeneBank Accession#

    NM_002495

    Protein Accession#

    NP_002486

    Gene Name

    NDUFS4

    Gene Alias

    AQDQ

    Gene Description

    NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)

    Omim ID

    252010 256000 602694

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq

    Other Designations

    NADH dehydrogenase (ubiquinone) Fe-S protein 4|NADH dehydrogenase (ubiquinone) iron-sulfur protein 4|NADH-coenzyme Q reductase, 18-KD|NADH-ubiquinone oxidoreductase 18 kDa subunit|mitochondrial respiratory chain complex I (18-KD subunit)

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All