NDUFS4 monoclonal antibody (M01), clone 1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDUFS4.
Immunogen
NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDUFS4 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NDUFS4 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NDUFS4 expression in transfected 293T cell line by NDUFS4 monoclonal antibody (M01), clone 1A1.
Lane 1: NDUFS4 transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDUFS4 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDUFS4 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NDUFS4 over-expressed 293 cell line, cotransfected with NDUFS4 Validated Chimera RNAi ( Cat # H00004724-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS4 monoclonal antibody (M01), clone 1A1 (Cat # H00004724-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NDUFS4
Entrez GeneID
4724GeneBank Accession#
NM_002495Protein Accession#
NP_002486Gene Name
NDUFS4
Gene Alias
AQDQ
Gene Description
NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Gene Ontology
HyperlinkGene Summary
This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) Fe-S protein 4|NADH dehydrogenase (ubiquinone) iron-sulfur protein 4|NADH-coenzyme Q reductase, 18-KD|NADH-ubiquinone oxidoreductase 18 kDa subunit|mitochondrial respiratory chain complex I (18-KD subunit)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com