Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFV1 monoclonal antibody (M01), clone 4A7

  • Catalog # : H00004723-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant NDUFV1.
  • Immunogen:
  • NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004723-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • NDUFV1 monoclonal antibody (M01), clone 4A7. Western Blot analysis of NDUFV1 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFV1 expression in transfected 293T cell line by NDUFV1 monoclonal antibody (M01), clone 4A7.

    Lane 1: NDUFV1 transfected lysate(50.8 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged NDUFV1 is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of NDUFV1 over-expressed 293 cell line, cotransfected with NDUFV1 Validated Chimera RNAi ( Cat # H00004723-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFV1 monoclonal antibody (M01), clone 4A7 (Cat # H00004723-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4723
  • Gene Name:
  • NDUFV1
  • Gene Alias:
  • CI-51kD,UQOR1
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
  • Gene Summary:
  • The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM
  • Other Designations:
  • Complex I-51kD,NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD),NADH-ubiquinone oxidoreductase 51 kDa subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook