NDUFV1 monoclonal antibody (M01), clone 4A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDUFV1.
Immunogen
NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDUFV1 monoclonal antibody (M01), clone 4A7. Western Blot analysis of NDUFV1 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of NDUFV1 expression in transfected 293T cell line by NDUFV1 monoclonal antibody (M01), clone 4A7.
Lane 1: NDUFV1 transfected lysate(50.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDUFV1 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NDUFV1 over-expressed 293 cell line, cotransfected with NDUFV1 Validated Chimera RNAi ( Cat # H00004723-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFV1 monoclonal antibody (M01), clone 4A7 (Cat # H00004723-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NDUFV1
Entrez GeneID
4723GeneBank Accession#
NM_007103Protein Accession#
NP_002466Gene Name
NDUFV1
Gene Alias
CI-51kD, UQOR1
Gene Description
NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Gene Ontology
HyperlinkGene Summary
The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM
Other Designations
Complex I-51kD|NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)|NADH-ubiquinone oxidoreductase 51 kDa subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Human Ind1, an iron-sulfur cluster assembly factor for respiratory complex I.
Sheftel AD, Stehling O, Pierik AJ, Netz DJ, Kerscher S, Elsasser HP, Wittig I, Balk J, Brandt U, Lill R.
Molecular and Cellular Biology 2009 Nov; 29(22):6059.
Application:WB-Tr, Human, HeLa cells.
-
Human Ind1, an iron-sulfur cluster assembly factor for respiratory complex I.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com