Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFV1 polyclonal antibody (A01)

  • Catalog # : H00004723-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NDUFV1.
  • Immunogen:
  • NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004723-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4723
  • Gene Name:
  • NDUFV1
  • Gene Alias:
  • CI-51kD,UQOR1
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
  • Gene Summary:
  • The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM
  • Other Designations:
  • Complex I-51kD,NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD),NADH-ubiquinone oxidoreductase 51 kDa subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook