NDUFS3 monoclonal antibody (M02), clone 1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 monoclonal antibody (M02), clone 1D6.
Lane 1: NDUFS3 transfected lysate(30.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDUFS3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of NDUFS3 transfected lysate using anti-NDUFS3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NDUFS3 MaxPab rabbit polyclonal antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of NDUFS3 over-expressed 293 cell line, cotransfected with NDUFS3 Validated Chimera RNAi ( Cat # H00004722-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS3 monoclonal antibody (M02), clone 1D6 (Cat # H00004722-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (54.56 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NDUFS3.
Immunogen
NDUFS3 (AAH00617, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NDUFS3 expression in transfected 293T cell line by NDUFS3 monoclonal antibody (M02), clone 1D6.
Lane 1: NDUFS3 transfected lysate(30.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NDUFS3 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of NDUFS3 transfected lysate using anti-NDUFS3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NDUFS3 MaxPab rabbit polyclonal antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NDUFS3 over-expressed 293 cell line, cotransfected with NDUFS3 Validated Chimera RNAi ( Cat # H00004722-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFS3 monoclonal antibody (M02), clone 1D6 (Cat # H00004722-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NDUFS3
Entrez GeneID
4722GeneBank Accession#
BC000617Protein Accession#
AAH00617Gene Name
NDUFS3
Gene Alias
-
Gene Description
NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
Gene Ontology
HyperlinkGene Summary
This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Overexpression of Lon contributes to survival and aggressive phenotype of cancer cells through mitochondrial complex I-mediated generation of reactive oxygen species.
Cheng CW, Kuo CY, Fan CC, Fang WC, Jiang SS, Lo YK, Wang TY, Kao MC, Lee AY.
Cell Death & Disease 2014 Jun; 4:e681.
Application：WB-Tr, Human, 293T, OEC-M1, FADU cells.
-
Overexpression of Lon contributes to survival and aggressive phenotype of cancer cells through mitochondrial complex I-mediated generation of reactive oxygen species.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com