NDUFC2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NDUFC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFC2 expression in mouse kidney.
Western Blot (Cell lysate)
NDUFC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFC2 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of NDUFC2 expression in transfected 293T cell line (H00004718-T02) by NDUFC2 MaxPab polyclonal antibody.
Lane 1: NDUFC2 transfected lysate(14.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NDUFC2 protein.
Immunogen
NDUFC2 (NP_004540.1, 1 a.a. ~ 119 a.a) full-length human protein.
Sequence
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (69); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NDUFC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFC2 expression in mouse kidney.Western Blot (Cell lysate)
NDUFC2 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFC2 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of NDUFC2 expression in transfected 293T cell line (H00004718-T02) by NDUFC2 MaxPab polyclonal antibody.
Lane 1: NDUFC2 transfected lysate(14.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NDUFC2
Entrez GeneID
4718GeneBank Accession#
NM_004549.3Protein Accession#
NP_004540.1Gene Name
NDUFC2
Gene Alias
B14.5b, NADHDH2
Gene Description
NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
Omim ID
603845Gene Ontology
HyperlinkGene Summary
NADH dehydrogenase (ubiquinone) 1
Other Designations
NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com