Product Browser

Last updated: 2017/6/18
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFB8 polyclonal antibody (A01)

  • Catalog # : H00004714-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant NDUFB8.
  • Immunogen:
  • NDUFB8 (AAH00466, 1 a.a. ~ 186 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004714-A01
    Western Blot detection against Immunogen (46.57 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4714
  • Gene Name:
  • NDUFB8
  • Gene Alias:
  • ASHI,CI-ASHI
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2 (8kD, AGGG),NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI),NADH:ubiquinone oxidoreductase ASHI subunit,OTTHUMP00000020835,OTTHUMP00000059404
  • RSS
  • YouTube
  • Linkedin
  • Facebook