NDUFB7 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NDUFB7 MaxPab polyclonal antibody. Western Blot analysis of NDUFB7 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of NDUFB7 expression in transfected 293T cell line (H00004713-T01) by NDUFB7 MaxPab polyclonal antibody.
Lane 1: NDUFB7 transfected lysate(15.07 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NDUFB7 protein.
Immunogen
NDUFB7 (NP_004137.2, 1 a.a. ~ 137 a.a) full-length human protein.
Sequence
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDUFB7 MaxPab polyclonal antibody. Western Blot analysis of NDUFB7 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of NDUFB7 expression in transfected 293T cell line (H00004713-T01) by NDUFB7 MaxPab polyclonal antibody.
Lane 1: NDUFB7 transfected lysate(15.07 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NDUFB7
Entrez GeneID
4713GeneBank Accession#
NM_004146.4Protein Accession#
NP_004137.2Gene Name
NDUFB7
Gene Alias
B18, CI-B18, MGC2480
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Omim ID
603842Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)|NADH-ubiquinone oxidoreductase B18 subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com