NDUFB6 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NDUFB6 protein.
Immunogen
NDUFB6 (NP_002484.1, 1 a.a. ~ 128 a.a) full-length human protein.
Sequence
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NDUFB6 MaxPab rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of NDUFB6 expression in transfected 293T cell line (H00004712-T01) by NDUFB6 MaxPab polyclonal antibody.
Lane 1: NDUFB6 transfected lysate(15.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NDUFB6
Entrez GeneID
4712GeneBank Accession#
NM_002493.3Protein Accession#
NP_002484.1Gene Name
NDUFB6
Gene Alias
B17, CI, MGC13675
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Omim ID
603322Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17)|NADH-ubiquinone oxidoreductase B17 subunit|NADH-ubiquinone oxidoreductase beta subunit, 6|OTTHUMP00000021179|OTTHUMP00000021180|complex I, mitochondrial respiratory chain, B17 subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com