Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004709-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NDUFB3 protein.
  • Immunogen:
  • NDUFB3 (NP_002482.1, 1 a.a. ~ 98 a.a) full-length human protein.
  • Sequence:
  • MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFB3 expression in transfected 293T cell line (H00004709-T02) by NDUFB3 MaxPab polyclonal antibody.

    Lane 1: NDUFB3 transfected lysate(11.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4709
  • Gene Name:
  • NDUFB3
  • Gene Alias:
  • B12
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa
  • Gene Summary:
  • The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. See NDUFA2 (MIM 602137).[supplied by OMIM
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3 (12kD, B12)
  • RSS
  • YouTube
  • Linkedin
  • Facebook