Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFB2 (Human) Recombinant Protein (P01)

  • Catalog # : H00004708-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NDUFB2 full-length ORF ( NP_004537.1, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004708-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4708
  • Gene Name:
  • NDUFB2
  • Gene Alias:
  • AGGG,CI-AGGG,MGC70788
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa
  • Gene Summary:
  • The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I. [provided by RefSeq
  • Other Designations:
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2 (8kD, AGGG),NADH-ubiquinone oxidoreductase AGGG subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook